ATP1B2 (Human) Recombinant Protein
  • ATP1B2 (Human) Recombinant Protein

ATP1B2 (Human) Recombinant Protein

Ref: AB-P7902
ATP1B2 (Human) Recombinant Protein

Información del producto

Human ATP1B2 (P14415, 68 a.a. - 290 a.a.) partial recombinant protein with His tag expressed in Baculovirus.
Información adicional
Size 50 ug
Gene Name ATP1B2
Gene Alias AMOG
Gene Description ATPase, Na+/K+ transporting, beta 2 polypeptide
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ADPDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKTHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 482

Enviar uma mensagem


ATP1B2 (Human) Recombinant Protein

ATP1B2 (Human) Recombinant Protein