Dkk1 (Mouse) Recombinant Protein
  • Dkk1 (Mouse) Recombinant Protein

Dkk1 (Mouse) Recombinant Protein

Ref: AB-P7899
Dkk1 (Mouse) Recombinant Protein

Información del producto

Mouse Dkk1 (O54908, 32 a.a. - 272 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name Dkk1
Gene Alias mdkk-1
Gene Description dickkopf homolog 1 (Xenopus laevis)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 50mM MES buffer, pH 6.5 (30% glycerol)
Gene ID 13380

Enviar uma mensagem


Dkk1 (Mouse) Recombinant Protein

Dkk1 (Mouse) Recombinant Protein