CD47 (Human) Recombinant Protein
  • CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein

Ref: AB-P7898
CD47 (Human) Recombinant Protein

Información del producto

Human CD47 (Q08722, 19 a.a. - 141 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.
Información adicional
Size 50 ug
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNELEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 961

Enviar uma mensagem


CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein