View larger
Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
AB-P7896
New product
IL17A (Canine) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | IL17A |
| Gene Alias | - |
| Gene Description | interleukin 17A |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Dog |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (20% glycerol) |
| Gene ID | 481837 |
More info
Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.