RNASE2 (Human) Recombinant Protein
  • RNASE2 (Human) Recombinant Protein

RNASE2 (Human) Recombinant Protein

Ref: AB-P7893
RNASE2 (Human) Recombinant Protein

Información del producto

Human RNASE2 (P10153, 28 a.a. - 161 a.a.) partial recombinant protein with His tag expressed in Baculovirus.
Información adicional
Size 500 ug
Gene Name RNASE2
Gene Alias EDN|RNS2
Gene Description ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (20% glycerol)
Gene ID 6036

Enviar uma mensagem


RNASE2 (Human) Recombinant Protein

RNASE2 (Human) Recombinant Protein