SEMA3C (Human) Recombinant Protein
  • SEMA3C (Human) Recombinant Protein

SEMA3C (Human) Recombinant Protein

Ref: AB-P7889
SEMA3C (Human) Recombinant Protein

Información del producto

Human SEMA3C (Q99985, 21 a.a. - 738 a.a.) partial recombinant protein with hIgG tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name SEMA3C
Gene Alias SEMAE|SemE
Gene Description sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq GSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGSKDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRS
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 10% glycerol)
Gene ID 10512

Enviar uma mensagem


SEMA3C (Human) Recombinant Protein

SEMA3C (Human) Recombinant Protein