Ace2 (Rat) Recombinant Protein
  • Ace2 (Rat) Recombinant Protein

Ace2 (Rat) Recombinant Protein

Ref: AB-P7878
Ace2 (Rat) Recombinant Protein

Información del producto

Rat Ace2 (Q5EGZ1, 18 a.a. - 740 a.a.) partial recombinant protein with His tag expressed in Baculovirus.
Información adicional
Size 500 ug
Gene Name Ace2
Gene Alias -
Gene Description angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKIAQNFSLQEIQNATIKRQLKALQQSGSSALSPDKNKQLNTILNTMSTIYSTGKVCNSMNPQECFLLEPGLDEIMATSTDYNRRLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGVEGYNYNRNQLIEDVENTFKEIKPLYEQLHAYVRTKLMEVYPSYISPTGCLPAHLLGDMWG
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 10% glycerol)
Gene ID 302668

Enviar uma mensagem


Ace2 (Rat) Recombinant Protein

Ace2 (Rat) Recombinant Protein