ERBB4 (Human) Recombinant Protein
  • ERBB4 (Human) Recombinant Protein

ERBB4 (Human) Recombinant Protein

Ref: AB-P7874
ERBB4 (Human) Recombinant Protein

Información del producto

Human ERBB4 (Q15303, 26 a.a. - 649 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name ERBB4
Gene Alias HER4|MGC138404|p180erbB4
Gene Description v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 10% glycerol)
Gene ID 2066

Enviar uma mensagem


ERBB4 (Human) Recombinant Protein

ERBB4 (Human) Recombinant Protein