CXCL8 (Canine) Recombinant Protein
  • CXCL8 (Canine) Recombinant Protein

CXCL8 (Canine) Recombinant Protein

Ref: AB-P7873
CXCL8 (Canine) Recombinant Protein

Información del producto

Canine CXCL8 (P41324, 28 a.a. - 101 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name IL8
Gene Alias -
Gene Description interleukin 8
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Dog
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 20% glycerol)
Gene ID 403850

Enviar uma mensagem


CXCL8 (Canine) Recombinant Protein

CXCL8 (Canine) Recombinant Protein