COMP (Human) Recombinant Protein
  • COMP (Human) Recombinant Protein

COMP (Human) Recombinant Protein

Ref: AB-P7867
COMP (Human) Recombinant Protein

Información del producto

Human COMP (P49747, 21 a.a. - 757 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
Información adicional
Size 500 ug
Gene Name COMP
Gene Alias EDM1|EPD1|MED|MGC131819|MGC149768|PSACH|THBS5
Gene Description cartilage oligomeric matrix protein
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq QGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGF
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 1311

Enviar uma mensagem


COMP (Human) Recombinant Protein

COMP (Human) Recombinant Protein