SEPW1 (Human) Recombinant Protein
  • SEPW1 (Human) Recombinant Protein

SEPW1 (Human) Recombinant Protein

Ref: AB-P7863
SEPW1 (Human) Recombinant Protein

Información del producto

Human SEPW1 (P63302, 1 a.a. - 87 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name SEPW1
Gene Alias selW
Gene Description selenoprotein W, 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MALAVRVVYCGACGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQG
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (20% glycerol, 1mM DTT)
Gene ID 6415

Enviar uma mensagem


SEPW1 (Human) Recombinant Protein

SEPW1 (Human) Recombinant Protein