GDF7 (Human) Recombinant Protein View larger

Human GDF7 partial recombinant protein with polyhistidine tag at the C-terminus expressed in <i>Escherichia coli</i>.

AB-P7802

New product

GDF7 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 20 ug
Gene Name GDF7
Gene Alias BMP12
Gene Description growth differentiation factor 7
Storage Conditions Lyophilized protein should be stored at -20ºC. Protein aliquots should be stored at-20ºC to -80ºC. This product is stable for one year. <br>Avoid repeated freeze/thaw cycles.
Specificity 23
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR with polyhistidine tag at the C-terminus.
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to a concentration not less than 100 ug/mL.
Gene ID 151449

More info

Human GDF7 partial recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.

Enviar uma mensagem

Human GDF7 partial recombinant protein with polyhistidine tag at the C-terminus expressed in <i>Escherichia coli</i>.

Human GDF7 partial recombinant protein with polyhistidine tag at the C-terminus expressed in <i>Escherichia coli</i>.