PDHX (Human) Recombinant Protein
  • PDHX (Human) Recombinant Protein

PDHX (Human) Recombinant Protein

Ref: AB-P7787
PDHX (Human) Recombinant Protein

Información del producto

Human PDHX (NP_003468, 54 a.a. - 501 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PDHX
Gene Alias DLDBP|E3BP|OPDX|PDX1|proX
Gene Description pyruvate dehydrogenase complex, component X
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 20% glycerol).
Gene ID 8050

Enviar uma mensagem


PDHX (Human) Recombinant Protein

PDHX (Human) Recombinant Protein