ERGIC3 (Human) Recombinant Protein
  • ERGIC3 (Human) Recombinant Protein

ERGIC3 (Human) Recombinant Protein

Ref: AB-P7780
ERGIC3 (Human) Recombinant Protein

Información del producto

Human ERGIC3 (NP_057050, 47 a.a. - 341 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name ERGIC3
Gene Alias C20orf47|CGI-54|Erv46|NY-BR-84|PRO0989|SDBCAG84|dJ477O4.2
Gene Description ERGIC and golgi 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQY
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 10% glycerol).
Gene ID 51614

Enviar uma mensagem


ERGIC3 (Human) Recombinant Protein

ERGIC3 (Human) Recombinant Protein