Gdf15 (Mouse) Recombinant Protein
  • Gdf15 (Mouse) Recombinant Protein

Gdf15 (Mouse) Recombinant Protein

Ref: AB-P7763
Gdf15 (Mouse) Recombinant Protein

Información del producto

Mouse Gdf15 (NP_035949.2, 189 a.a. - 303 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name Gdf15
Gene Alias MIC-1|NAG-1|SBF
Gene Description growth differentiation factor 15
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).
Gene ID 23886

Enviar uma mensagem


Gdf15 (Mouse) Recombinant Protein

Gdf15 (Mouse) Recombinant Protein