SERPINB8 (Human) Recombinant Protein
  • SERPINB8 (Human) Recombinant Protein

SERPINB8 (Human) Recombinant Protein

Ref: AB-P7759
SERPINB8 (Human) Recombinant Protein

Información del producto

Human SERPINB8 (NP_942130, 1 a.a. - 374 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name SERPINB8
Gene Alias CAP2|PI8
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 8
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLP
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In In 20mM Tris-HCl buffer, pH8.0 (0.15M NaCl, 1mM DTT, 30% glycerol).
Gene ID 5271

Enviar uma mensagem


SERPINB8 (Human) Recombinant Protein

SERPINB8 (Human) Recombinant Protein