RTP4 (Human) Recombinant Protein
  • RTP4 (Human) Recombinant Protein

RTP4 (Human) Recombinant Protein

Ref: AB-P7757
RTP4 (Human) Recombinant Protein

Información del producto

Human RTP4 (NP_071430, 1 a.a. - 224a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name RTP4
Gene Alias IFRG28
Gene Description receptor (chemosensory) transporter protein 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQRSWASAQVQILCHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPD
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 20% glycerol).
Gene ID 64108

Enviar uma mensagem


RTP4 (Human) Recombinant Protein

RTP4 (Human) Recombinant Protein