FUCA2 (Human) Recombinant Protein
  • FUCA2 (Human) Recombinant Protein

FUCA2 (Human) Recombinant Protein

Ref: AB-P7752
FUCA2 (Human) Recombinant Protein

Información del producto

Human FUCA2 (NP_114409, 94 a.a. - 467 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name FUCA2
Gene Alias MGC1314|dJ20N2.5
Gene Description fucosidase, alpha-L- 2, plasma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHSATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRGTVVTN
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20mM Phosphate buffer, pH8.0 (10% glycerol).
Gene ID 2519

Enviar uma mensagem


FUCA2 (Human) Recombinant Protein

FUCA2 (Human) Recombinant Protein