Vegfa (Rat) Recombinant Protein
  • Vegfa (Rat) Recombinant Protein

Vegfa (Rat) Recombinant Protein

Ref: AB-P7750
Vegfa (Rat) Recombinant Protein

Información del producto

Rat Vegfa (NP_001103804, 206 a.a. - 325 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Vegfa
Gene Alias VEGF164|Vegf
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (50% glycerol).
Gene ID 83785

Enviar uma mensagem


Vegfa (Rat) Recombinant Protein

Vegfa (Rat) Recombinant Protein