CEACAM3 (Human) Recombinant Protein
  • CEACAM3 (Human) Recombinant Protein

CEACAM3 (Human) Recombinant Protein

Ref: AB-P7749
CEACAM3 (Human) Recombinant Protein

Información del producto

Human CEACAM3 (NP_001264092, 35 a.a. - 155 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 250 ug
Gene Name CEACAM3
Gene Alias CD66D|CEA|CGM1|MGC119875|W264|W282
Gene Description carcinoembryonic antigen-related cell adhesion molecule 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (20% glycerol).
Gene ID 1084

Enviar uma mensagem


CEACAM3 (Human) Recombinant Protein

CEACAM3 (Human) Recombinant Protein