Gdf5 (Mouse) Recombinant Protein
  • Gdf5 (Mouse) Recombinant Protein

Gdf5 (Mouse) Recombinant Protein

Ref: AB-P7744
Gdf5 (Mouse) Recombinant Protein

Información del producto

Mouse Gdf5 (NP_032135, 376 a.a. - 495 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name Gdf5
Gene Alias Cdmp-1|bp|brp
Gene Description growth differentiation factor 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 14563

Enviar uma mensagem


Gdf5 (Mouse) Recombinant Protein

Gdf5 (Mouse) Recombinant Protein