CD37 (Human) Recombinant Protein
  • CD37 (Human) Recombinant Protein

CD37 (Human) Recombinant Protein

Ref: AB-P7734
CD37 (Human) Recombinant Protein

Información del producto

Human CD37 (NP_001765, 112 a.a. - 241 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name CD37
Gene Alias GP52-40|MGC120234|TSPAN26
Gene Description CD37 molecule
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 951

Enviar uma mensagem


CD37 (Human) Recombinant Protein

CD37 (Human) Recombinant Protein