GTF2H5 (Human) Recombinant Protein
  • GTF2H5 (Human) Recombinant Protein

GTF2H5 (Human) Recombinant Protein

Ref: AB-P7732
GTF2H5 (Human) Recombinant Protein

Información del producto

Human GTF2H5 (NP_997001, 1 a.a. - 71 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name GTF2H5
Gene Alias C6orf175|TFB5|TGF2H5|TTD|TTD-A|TTDA|bA120J8.2
Gene Description general transcription factor IIH, polypeptide 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 404672

Enviar uma mensagem


GTF2H5 (Human) Recombinant Protein

GTF2H5 (Human) Recombinant Protein