SDHAF1 (Human) Recombinant Protein View larger

Human SDHAF1 (NP_001036096, 1 a.a. - 115 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>

AB-P7729

New product

SDHAF1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.


Data sheet

Size 100 ug
Gene Name LOC644096
Gene Alias -
Gene Description hypothetical protein LOC644096
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGSQPDDGDSPRNPHDSTGAPETRPDGR
Form Liquid
Recomended Dilution SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (0.1mM PMSF, 2 mM DTT, 30% glycerol).
Gene ID 644096

More info

Human SDHAF1 (NP_001036096, 1 a.a. - 115 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human SDHAF1 (NP_001036096, 1 a.a. - 115 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>

Human SDHAF1 (NP_001036096, 1 a.a. - 115 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>