PIH1D2 (Human) Recombinant Protein
  • PIH1D2 (Human) Recombinant Protein

PIH1D2 (Human) Recombinant Protein

Ref: AB-P7719
PIH1D2 (Human) Recombinant Protein

Información del producto

Human PIH1D2 (NP_620144, 1 a.a. - 315 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PIH1D2
Gene Alias -
Gene Description PIH1 domain containing 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMETSSKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAYNPDVLHAAEKDQVKKNQLIQMAMKCIEEKFQFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQVSGKAVCLIEEISSTEIQVEMKM
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 20% glycerol).
Gene ID 120379

Enviar uma mensagem


PIH1D2 (Human) Recombinant Protein

PIH1D2 (Human) Recombinant Protein