CD300E (Human) Recombinant Protein
  • CD300E (Human) Recombinant Protein

CD300E (Human) Recombinant Protein

Ref: AB-P7712
CD300E (Human) Recombinant Protein

Información del producto

Human CD300E (NP_852114.2, 18 a.a. - 173 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name CD300E
Gene Alias CD300LE|CLM2|IREM2
Gene Description CD300e molecule
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPH
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.4M Urea).
Gene ID 342510

Enviar uma mensagem


CD300E (Human) Recombinant Protein

CD300E (Human) Recombinant Protein