View larger
Human CD300E (NP_852114.2, 18 a.a. - 173 a.a ) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P7712
New product
CD300E (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | CD300E |
| Gene Alias | CD300LE|CLM2|IREM2 |
| Gene Description | CD300e molecule |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPH |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.4M Urea). |
| Gene ID | 342510 |
More info
Human CD300E (NP_852114.2, 18 a.a. - 173 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.