View larger
Human YBX1 (NP_004550, 1 a.a. - 324 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P7710
New product
YBX1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | YBX1 |
| Gene Alias | BP-8|CSDA2|CSDB|DBPB|MDR-NF1|MGC104858|MGC110976|MGC117250|NSEP-1|NSEP1|YB-1|YB1 |
| Gene Description | Y box binding protein 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRP |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In PBS, pH 7.4 (20% glycerol). |
| Gene ID | 4904 |
More info
Human YBX1 (NP_004550, 1 a.a. - 324 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.