HSBP1L1 (Human) Recombinant Protein
  • HSBP1L1 (Human) Recombinant Protein

HSBP1L1 (Human) Recombinant Protein

Ref: AB-P7701
HSBP1L1 (Human) Recombinant Protein

Información del producto

Human HSBP1L1 (AAI57849, 1 a.a. - 74 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name LOC440498
Gene Alias FLJ10967|MGC189743
Gene Description heat shock factor binding protein 1-like
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMDVRGPEAPGGRALRDAAENLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLKT
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 440498

Enviar uma mensagem


HSBP1L1 (Human) Recombinant Protein

HSBP1L1 (Human) Recombinant Protein