ACTR3 (Human) Recombinant Protein View larger

Human ACTR3 (NP_005712, 1 a.a. - 418 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P7686

New product

ACTR3 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.


Data sheet

Size 500 ug
Gene Name ACTR3
Gene Alias ARP3
Gene Description ARP3 actin-related protein 3 homolog (yeast)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.25mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYS
Form Liquid
Recomended Dilution SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 10096

More info

Human ACTR3 (NP_005712, 1 a.a. - 418 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human ACTR3 (NP_005712, 1 a.a. - 418 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human ACTR3 (NP_005712, 1 a.a. - 418 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.