RALY (Human) Recombinant Protein
  • RALY (Human) Recombinant Protein

RALY (Human) Recombinant Protein

Ref: AB-P7685
RALY (Human) Recombinant Protein

Información del producto

Human RALY (NP_057951, 1 a.a. - 306 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name RALY
Gene Alias HNRPCL2|MGC117312|P542
Gene Description RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse))
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGG
Form Liquid
Recomended Dilution SDS-PAGE
Denatured
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 22913

Enviar uma mensagem


RALY (Human) Recombinant Protein

RALY (Human) Recombinant Protein