LCN1 (Human) Recombinant Protein
  • LCN1 (Human) Recombinant Protein

LCN1 (Human) Recombinant Protein

Ref: AB-P7667
LCN1 (Human) Recombinant Protein

Información del producto

Human LCN1 (NP_001239546, 19 a.a. - 176 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name LCN1
Gene Alias MGC71975|PMFA|TP|VEGP
Gene Description lipocalin 1 (tear prealbumin)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 10% glycerol).
Gene ID 3933

Enviar uma mensagem


LCN1 (Human) Recombinant Protein

LCN1 (Human) Recombinant Protein