IGF1 (Bovine) Recombinant Protein
  • IGF1 (Bovine) Recombinant Protein

IGF1 (Bovine) Recombinant Protein

Ref: AB-P7663
IGF1 (Bovine) Recombinant Protein

Información del producto

Bovine IGF1 (P07455, 50 a.a. - 119 a.a.) partial recombinant protein expressed with an N-terminal Met in Human cells.
Información adicional
Size 10 ug
Gene Name IGF1
Gene Alias IGF-1|IGF-I
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 281239

Enviar uma mensagem


IGF1 (Bovine) Recombinant Protein

IGF1 (Bovine) Recombinant Protein