SLAMF7 (Human) Recombinant Protein
  • SLAMF7 (Human) Recombinant Protein

SLAMF7 (Human) Recombinant Protein

Ref: AB-P7657
SLAMF7 (Human) Recombinant Protein

Información del producto

Human SLAMF7 (Q9NQ25, 23 a.a. - 226 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.
Información adicional
Size 100 ug
Gene Name SLAMF7
Gene Alias 19A|CD319|CRACC|CS1
Gene Description SLAM family member 7
Storage Conditions Store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 57823

Enviar uma mensagem


SLAMF7 (Human) Recombinant Protein

SLAMF7 (Human) Recombinant Protein