Osm (Rat) Recombinant Protein View larger

Rat Osm (Q65Z15, 26 a.a. - 239 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P7637

New product

Osm (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 69 pontos de fidelização. Seu carrinho totalizará 69 pontos de fidelização que podem ser convertidos num vale de desconto de 276.00EUR.


Data sheet

Size 1 mg
Gene Name Osm
Gene Alias -
Gene Description oncostatin M
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 289747

More info

Rat Osm (Q65Z15, 26 a.a. - 239 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Rat Osm (Q65Z15, 26 a.a. - 239 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Rat Osm (Q65Z15, 26 a.a. - 239 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.