Cxcl10 (Mouse) Recombinant Protein
  • Cxcl10 (Mouse) Recombinant Protein

Cxcl10 (Mouse) Recombinant Protein

Ref: AB-P7636
Cxcl10 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl10 (P17515, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Cxcl10
Gene Alias C7|CRG-2|INP10|IP-10|IP10|Ifi10|Scyb10|gIP-10|mob-1
Gene Description chemokine (C-X-C motif) ligand 10
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 15945

Enviar uma mensagem


Cxcl10 (Mouse) Recombinant Protein

Cxcl10 (Mouse) Recombinant Protein