Mif (Mouse) Recombinant Protein
  • Mif (Mouse) Recombinant Protein

Mif (Mouse) Recombinant Protein

Ref: AB-P7630
Mif (Mouse) Recombinant Protein

Información del producto

Mouse Mif (P34884, 1 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Mif
Gene Alias GIF|Glif|MGC107654
Gene Description macrophage migration inhibitory factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 17319

Enviar uma mensagem


Mif (Mouse) Recombinant Protein

Mif (Mouse) Recombinant Protein