Egf (Rat) Recombinant Protein
  • Egf (Rat) Recombinant Protein

Egf (Rat) Recombinant Protein

Ref: AB-P7629
Egf (Rat) Recombinant Protein

Información del producto

Rat Egf (P07522, 974 a.a. - 1026 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Egf
Gene Alias -
Gene Description epidermal growth factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 25313

Enviar uma mensagem


Egf (Rat) Recombinant Protein

Egf (Rat) Recombinant Protein