Il10 (Rat) Recombinant Protein
  • Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein

Ref: AB-P7627
Il10 (Rat) Recombinant Protein

Información del producto

Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Il10
Gene Alias IL10X
Gene Description interleukin 10
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL
Gene ID 25325

Enviar uma mensagem


Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein