GMFB (Human) Recombinant Protein
  • GMFB (Human) Recombinant Protein

GMFB (Human) Recombinant Protein

Ref: AB-P7625
GMFB (Human) Recombinant Protein

Información del producto

Human GMFB (P60983, 1 a.a. - 142 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name GMFB
Gene Alias GMF
Gene Description glia maturation factor, beta
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 2764

Enviar uma mensagem


GMFB (Human) Recombinant Protein

GMFB (Human) Recombinant Protein