CCL3 (Human) Recombinant Protein
  • CCL3 (Human) Recombinant Protein

CCL3 (Human) Recombinant Protein

Ref: AB-P7623
CCL3 (Human) Recombinant Protein

Información del producto

Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name CCL3
Gene Alias G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
Gene Description chemokine (C-C motif) ligand 3
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 6348

Enviar uma mensagem


CCL3 (Human) Recombinant Protein

CCL3 (Human) Recombinant Protein