SIGLEC15 (Human) Recombinant Protein
  • SIGLEC15 (Human) Recombinant Protein

SIGLEC15 (Human) Recombinant Protein

Ref: AB-P7620
SIGLEC15 (Human) Recombinant Protein

Información del producto

Human SIGLEC15 (Q6ZMC9, 20 a.a. - 263 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 50 ug
Gene Name SIGLEC15
Gene Alias CD33L3|HsT1361|SIGLEC-15
Gene Description sialic acid binding Ig-like lectin 15
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 284266

Enviar uma mensagem


SIGLEC15 (Human) Recombinant Protein

SIGLEC15 (Human) Recombinant Protein