CEACAM5 (Human) Recombinant Protein
  • CEACAM5 (Human) Recombinant Protein

CEACAM5 (Human) Recombinant Protein

Ref: AB-P7615
CEACAM5 (Human) Recombinant Protein

Información del producto

Human CEACAM5 (P06731, 35 a.a. - 685 a.a.) partial recombinant protein with His tag at C-terminus expressed in CHO 3E7 cells.
Información adicional
Size 50 ug
Gene Name CEACAM5
Gene Alias CD66e|CEA|DKFZp781M2392
Gene Description carcinoembryonic antigen-related cell adhesion molecule 5
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNI
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 1048

Enviar uma mensagem


CEACAM5 (Human) Recombinant Protein

CEACAM5 (Human) Recombinant Protein