RSPO1 (Human) Recombinant Protein
  • RSPO1 (Human) Recombinant Protein

RSPO1 (Human) Recombinant Protein

Ref: AB-P7583
RSPO1 (Human) Recombinant Protein

Información del producto

Human RSPO1 (Q2MKA7, 21 a.a. - 263 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.
Información adicional
Size 10 ug
Gene Name RSPO1
Gene Alias CRISTIN3|FLJ40906|RSPO
Gene Description R-spondin homolog (Xenopus laevis)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 284654

Enviar uma mensagem


RSPO1 (Human) Recombinant Protein

RSPO1 (Human) Recombinant Protein