Tgfb2 (Mouse) Recombinant Protein
  • Tgfb2 (Mouse) Recombinant Protein

Tgfb2 (Mouse) Recombinant Protein

Ref: AB-P7582
Tgfb2 (Mouse) Recombinant Protein

Información del producto

Mouse Tgfb2 (P27090, 303 a.a. - 414 a.a.) partial recombinant protein expressed in Human cells.
Información adicional
Size 10 ug
Gene Name Tgfb2
Gene Alias BB105277|Tgf-beta2|Tgfb-2
Gene Description transforming growth factor, beta 2
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
Form Lyophilized
Storage Buffer Lyophilized from 4 mM HCl up to 100 ug/mL
Gene ID 21808

Enviar uma mensagem


Tgfb2 (Mouse) Recombinant Protein

Tgfb2 (Mouse) Recombinant Protein