TGFB2 (Human) Recombinant Protein
  • TGFB2 (Human) Recombinant Protein

TGFB2 (Human) Recombinant Protein

Ref: AB-P7579
TGFB2 (Human) Recombinant Protein

Información del producto

Human TGFB2 (P61812, 303 a.a. - 414 a.a.) partial recombinant protein expressed in Human cells.
Información adicional
Size 10 ug
Gene Name TGFB2
Gene Alias MGC116892|TGF-beta2
Gene Description transforming growth factor, beta 2
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 7042

Enviar uma mensagem


TGFB2 (Human) Recombinant Protein

TGFB2 (Human) Recombinant Protein