LAG3 (Human) Recombinant Protein
  • LAG3 (Human) Recombinant Protein

LAG3 (Human) Recombinant Protein

Ref: AB-P7573
LAG3 (Human) Recombinant Protein

Información del producto

Human LAG3 (P18627, 23 a.a. - 450 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.
Información adicional
Size 1 mg
Gene Name LAG3
Gene Alias CD223
Gene Description lymphocyte-activation gene 3
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3902

Enviar uma mensagem


LAG3 (Human) Recombinant Protein

LAG3 (Human) Recombinant Protein