Il9 (Mouse) Recombinant Protein
  • Il9 (Mouse) Recombinant Protein

Il9 (Mouse) Recombinant Protein

Ref: AB-P7561
Il9 (Mouse) Recombinant Protein

Información del producto

Mouse Il9 (P15247, 19 a.a. - 144 a.a.) partial recombinant protein expressed in HEK294 cell.
Información adicional
Size 10 ug
Gene Name Il9
Gene Alias Il-9|P40
Gene Description interleukin 9
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 16198

Enviar uma mensagem


Il9 (Mouse) Recombinant Protein

Il9 (Mouse) Recombinant Protein