View larger
Mouse Pdcd1 (Q02242, 25 a.a. - 167 a.a.) partial recombinant protein with hFc tag C-terminus expressed in HEK293 cell.
AB-P7548
New product
Pdcd1 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | Pdcd1 |
| Gene Alias | Ly101|PD-1|Pdc1 |
| Gene Description | programmed cell death 1 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 18566 |
More info
Mouse Pdcd1 (Q02242, 25 a.a. - 167 a.a.) partial recombinant protein with hFc tag C-terminus expressed in HEK293 cell.