TNFRSF9 (Human) Recombinant Protein
  • TNFRSF9 (Human) Recombinant Protein

TNFRSF9 (Human) Recombinant Protein

Ref: AB-P7547
TNFRSF9 (Human) Recombinant Protein

Información del producto

Human TNFRSF9 (Q07011, 24 a.a. - 186 a.a.) partial recombinant protein with hFc tag C-terminus expressed in CHO cell.
Información adicional
Size 1 mg
Gene Name TNFRSF9
Gene Alias 4-1BB|CD137|CDw137|ILA|MGC2172
Gene Description tumor necrosis factor receptor superfamily, member 9
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3604

Enviar uma mensagem


TNFRSF9 (Human) Recombinant Protein

TNFRSF9 (Human) Recombinant Protein