RBP4 (Human) Recombinant Protein
  • RBP4 (Human) Recombinant Protein

RBP4 (Human) Recombinant Protein

Ref: AB-P7543
RBP4 (Human) Recombinant Protein

Información del producto

Human RBP4 (P02753, 19 a.a. - 201 a.a.) partial recombinant protein with His tag C-terminus expressed in HEK293 cell.
Información adicional
Size 10 ug
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5950

Enviar uma mensagem


RBP4 (Human) Recombinant Protein

RBP4 (Human) Recombinant Protein