RBP4 (Human) Recombinant Protein View larger

Human RBP4 (P02753, 19 a.a. - 201 a.a.) partial recombinant protein with His tag C-terminus expressed in HEK293 cell.

AB-P7543

New product

RBP4 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 5950

More info

Human RBP4 (P02753, 19 a.a. - 201 a.a.) partial recombinant protein with His tag C-terminus expressed in HEK293 cell.

Enviar uma mensagem

Human RBP4 (P02753, 19 a.a. - 201 a.a.) partial recombinant protein with His tag C-terminus expressed in HEK293 cell.

Human RBP4 (P02753, 19 a.a. - 201 a.a.) partial recombinant protein with His tag C-terminus expressed in HEK293 cell.